PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01008.1.g00080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 265aa    MW: 29064.5 Da    PI: 5.7347
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01008.1.g00080.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.92.7e-191461148
                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                    rg+W++eEd++lv +++q+G ++W++ ++  g+ R++k+c++rw +yl
  Zmw_sc01008.1.g00080.1.am.mkhc 14 RGAWSPEEDQRLVAYIQQHGHPNWRALPKQAGLLRCGKSCRLRWINYL 61
                                    89******************************99************97 PP

2Myb_DNA-binding53.17.1e-1767112148
                                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                     rg+++++E+el+++++++lG++ W++Ia+ ++ gRt++++k+ w+++l
  Zmw_sc01008.1.g00080.1.am.mkhc  67 RGNFSADEEELIIRLHQELGNR-WSAIAAQLP-GRTDNEIKNVWHTHL 112
                                     89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.385961IPR017930Myb domain
SuperFamilySSF466897.49E-3011108IPR009057Homeodomain-like
SMARTSM007172.1E-131363IPR001005SANT/Myb domain
PfamPF002492.3E-161461IPR001005SANT/Myb domain
CDDcd001671.11E-101661No hitNo description
PROSITE profilePS5129425.30262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-2765116IPR009057Homeodomain-like
SMARTSM007175.5E-1566114IPR001005SANT/Myb domain
PfamPF002491.3E-1567112IPR001005SANT/Myb domain
CDDcd001676.45E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MGRAPCCAKE GLRRGAWSPE EDQRLVAYIQ QHGHPNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF SADEEELIIR LHQELGNRWS AIAAQLPGRT DNEIKNVWHT HLKKRLQDAG  120
SGGRKKKQAR KSKTAKKATQ EATADVDGDE PSQFTVASPE LSSSVSSGVT CSTATESTAA  180
ASSADNAATT SASQVALKAE TESFSTAEFP PIDESFWASS DVMDMDLGAM DEELGLASSA  240
ATRDEDMEFW KMLLESGDMR DLTVM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-25121162105C-Myb DNA-Binding Domain
1mse_C1e-25121162105C-Myb DNA-Binding Domain
1gv2_A1e-25121162105MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-251211625128MYB TRANSFORMING PROTEIN
1h89_C4e-25121169159MYB PROTO-ONCOGENE PROTEIN
1h88_C4e-25121169159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112126KKRLQDAGSGGRKKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982863.11e-131PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH46e-82MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A0A9HAP11e-136A0A0A9HAP1_ARUDO; Myb39
STRINGSi040527m1e-131(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563